ich kann mein guthaben nicht aufladen vodafone

"context" : "", "action" : "rerender" "action" : "rerender" Um die Aufladesperre aufheben zu lassen, kontaktieren Sie bitte unsere Häufige Fragen und Antworten. ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] "}); "actions" : [ count = 0; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_3","feedbackSelector":".InfoMessage"}); "disableLinks" : "false", } }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "envParam:feedbackData", ] "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", { $('section.header-announcement').slideUp(); { "dialogKey" : "dialogKey" "disableKudosForAnonUser" : "false", Wann bekomme ich meinen Code? "closeEvent" : "LITHIUM:lightboxCloseEvent", "event" : "addMessageUserEmailSubscription", $(document).ready(function(){ "action" : "rerender" Mein BILDmobil: im Mitgliederbereich einfach Guthaben aufladen oder persönliche Daten ändern. }, "context" : "envParam:entity", { ] { { $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); resetMenu(); Dann lad sie kostenlos bei Google Play oder im App Store herunter. ;(function($) { { } Seit 2019 hat sich die Ausrichtung des Unternehmens aber etwas geändert und Kunden können nun auch reine Prepaidkarten beim Discounter erwerben. } { "useCountToKudo" : "false", Hier eingeben… Name* E-Mail* Website. ] "context" : "envParam:entity", { ] "actions" : [ Kurze Zeit später erscheint der Aufladebetrag auf dem Display. } }, { Achtung: Es kann vorkommen, dass die Emails im Spam-Ordner landen. $('#vodafone-community-header .lia-search-toggle').click(function() { { ] "actions" : [ "action" : "rerender" ] LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } "event" : "MessagesWidgetEditAction", var clickedDomElement = $(this); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); "Wie lade ich mein Vodafone-Guthaben auf?" }, LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/61825","ajaxErrorEventName":"LITHIUM:ajaxError","token":"yFGHNbeAnw7j4Zc4PSyu9Fo3ATGo-MRhjbxRAF7LYOc. }, "context" : "envParam:entity", ] { "revokeMode" : "true", }, { { Das Google-Play-Guthaben kauf­st Du entwed­er im Inter­net oder in Geschäften: Viele Drogeriemärk­te, Elek­tron­iklä­den, Super­märk­te, Kaufhäuser oder Tankstellen bieten Geschenkkarten für Google Play an. } auf „Senden“. ] { { ] "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", das handy wird sehr wenig benützt ich benötige aber diese rufnummer in unregelmässigen abständen und wurde auch an alle wichtigen personen weitergegeben. }); "action" : "pulsate" "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", "parameters" : { "actions" : [ // Oops. "action" : "rerender" { "useCountToKudo" : "false", Guthaben-Abfrage bei Vodafone . Super easy – der schnelle … ] $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { "includeRepliesModerationState" : "false", "action" : "pulsate" } "action" : "addClassName" LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'jHj_aIZotrXAruiSY2A_JgcPulD9Poz9bTswzoeEmJI. ] "actions" : [ "action" : "pulsate" "context" : "", "actions" : [ "event" : "removeMessageUserEmailSubscription", "event" : "addMessageUserEmailSubscription", Ich kann meine Prepaid-Karte nicht aufladen. "action" : "rerender" }, { "closeEvent" : "LITHIUM:lightboxCloseEvent", "context" : "envParam:quiltName,message", "disableLabelLinks" : "false", "action" : "rerender" "ajaxEvent" : "LITHIUM:lightboxRenderComponent", var keycodes = { "event" : "AcceptSolutionAction", "selector" : "#kudosButtonV2_1", "selector" : "#messageview", Hier ist ebenfalls die Einrichtung einer automatischen Aufladung möglich. "initiatorBinding" : true, } ctaHTML += "Lösung noch nicht gefunden? { { $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ count++; "actions" : [ "context" : "envParam:selectedMessage", "disableLinks" : "false", "actions" : [ "actions" : [ "event" : "MessagesWidgetEditAnswerForm", ] var keycodes = { ] Bist du sicher, dass du fortfahren möchtest? } { { ] "componentId" : "kudos.widget.button", "action" : "rerender" "action" : "pulsate" Option 1: Öffne die Anruf-App auf deinem Smartphone, indem du auf das Telefonhörer-Symbol tippst. { // Reset the conditions so that someone can do it all again. }, "actions" : [ "eventActions" : [ "displaySubject" : "true", })(LITHIUM.jQuery); // Pull in global jQuery reference "actions" : [ } else { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "actions" : [ Per Tastenkombination: *100*(Aufladecode)# eintippen und anschließend die Wahltaste drücken. { $(document).ready(function(){ { "event" : "QuickReply", "actions" : [ Egal ob Guthaben fürs Smartphone, für Games oder zum Shoppen, bei MeinGuthaben findest du alle Prepaid-Anbieter an einem Ort. "action" : "rerender" "includeRepliesModerationState" : "false", "action" : "rerender" element.removeClass('active'); 2. Ich habe genau wie darauf beschrieben und wie ich es immer gemacht die Aufladenummer (22922) angerufen. ] }, "messageViewOptions" : "1111110111111111111110111110100101001101" "action" : "rerender" Es gibt zwei Optionen, wie du Dein Vodafone Prepaid Guthaben aufladen kannst. } "actions" : [ ] "actions" : [ //$('#vodafone-community-header').css('display','block'); LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); })(LITHIUM.jQuery); //if(height > 430) { }, } $(document).ready(function(){ "context" : "", var cookieDomain = 'forum.vodafone.de'; } }, "action" : "rerender" "action" : "rerender" { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); "forceSearchRequestParameterForBlurbBuilder" : "false", Das vorhandene Paysafecard-Guthaben könnt ihr für euren nächsten Online-Einkauf nutzen und so z. "event" : "approveMessage", } element.siblings('li').removeClass('active'); { "buttonDialogCloseAlt" : "Schließen", "context" : "envParam:quiltName,message", LITHIUM.Dialog({ "actions" : [ { "event" : "expandMessage", "displaySubject" : "true", } "action" : "rerender" LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchform_65b50b2b75783d","nodesModel":{"user|user":{"title":"Benutzer","inputSelector":".lia-search-input-user"},"vodafonede|community":{"title":"Community-Suche: Archiv_CallYa","inputSelector":".lia-search-input-message"},"Archiv_CallYa|forum-board":{"title":"Board-Suche: Archiv_CallYa","inputSelector":".lia-search-input-message"},"Vertrag|category":{"title":"Kategorie-Suche: Archiv_CallYa","inputSelector":".lia-search-input-message"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_65b50b2b75783d_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); // console.log('watching: ' + key); Ich kann da nicht anrufen wird gesagt weil ich nicht genug Guthaben habe . "action" : "rerender" var handleClose = function(event) { } } { { { "event" : "QuickReply", "context" : "envParam:quiltName,message", ] "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/61825","ajaxErrorEventName":"LITHIUM:ajaxError","token":"mH4KG58526KjhN0C6Di8v6zn7mP4jFuMJiXcm__lyrM. }, }, } }); else { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/61825","ajaxErrorEventName":"LITHIUM:ajaxError","token":"g7NAHIq29hTcqFIab5z4sGRYzUwigWkEyqhJyYONcyE. { "context" : "", "action" : "rerender" "action" : "rerender" "event" : "unapproveMessage", }, ] "useTruncatedSubject" : "true", "action" : "rerender" "actions" : [ "useSubjectIcons" : "true", "context" : "", LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'jHj_aIZotrXAruiSY2A_JgcPulD9Poz9bTswzoeEmJI. "action" : "pulsate" }, Das vorhandene Guthaben habe ich mir nach der Nutzung immer aufgeschrieben - zuletzt ca. "context" : "", }); "buttonDialogCloseAlt" : "Schließen", "action" : "rerender" { }, } ] "action" : "rerender" "eventActions" : [ }, "context" : "", "selector" : "#messageview_1", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox","feedbackSelector":".InfoMessage"}); "action" : "pulsate" }, guthaben aufladen geht nicht!!!! { ] window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":358,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBFcKAFRWDlABBRgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVQV1AMUAYDXxQGW1VSSQFWVwZIDgMKAU8EUlAMA1FRUVRXDAFAThUPVn1bVgB\/AhsIQCNFB11aQm0mVwpVawNAG0ZeUGZXFkIwC2MXB0UdFwkWYSB6I3pmQgtTRHNhe39FWwNKQQMFUhcVZHx3N3NGTV0SC1RKXFcJDUV6L3R7NkIIRkhO"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } { "actions" : [ "triggerEvent" : "click", } }, { "event" : "kudoEntity", Der 13-stellige Zifferncode des Auflade-Bons wurde 3 Mal falsch eingegeben. "context" : "", if ( watching ) { } "}); "event" : "ProductAnswerComment", "useCountToKudo" : "false", "event" : "addThreadUserEmailSubscription", "action" : "pulsate" .attr('aria-expanded','true') "actions" : [ "action" : "rerender" "initiatorDataMatcher" : "data-lia-kudos-id" "componentId" : "kudos.widget.button", LITHIUM.AjaxSupport.ComponentEvents.set({ FYVE-Kunde kannst du dich hier einloggen und ganz einfach deine Guthaben aufladen und deine Verbindungsübersichen abrufen. "dialogContentCssClass" : "lia-panel-dialog-content", } "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ ] } LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1979172,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.Auth.CHECK_SESSION_TOKEN = 'YwSMvtfspEHJQ9Mw2bIJ9cbwJG_2TwuR7Q_hHK8IHy8. "action" : "rerender" Anstelle einer Telefonnummer gibst du nun folgenden USSD-Code ein: *100*(Aufladecode)# Bestätige die Eingabe, indem Du auf Anrufen klickst. Prepaid. var count = 0; $(document).ready(function() { }, "context" : "", "displayStyle" : "horizontal", { "linkDisabled" : "false" // console.log('watching: ' + key); "event" : "ProductAnswerComment", } "defaultAriaLabel" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "action" : "rerender" } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); { }, "parameters" : { } "entity" : "1979181", }, })(LITHIUM.jQuery); var ctaHTML = ''; ] /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "truncateBody" : "true", "event" : "approveMessage", ] "context" : "envParam:quiltName,message,product,contextId,contextUrl", "dialogKey" : "dialogKey" ] } event.preventDefault(); Weitere Infos findest Du auf unserer … "showCountOnly" : "false", { Sie können mit der Direktaufladung nicht nur Ihre eigene Rufnummer, sondern auch die Rufnummer von anderen wie beispielsweise Familienmitgliedern aufladen. } if ( count == neededkeys.length ) { "activecastFullscreen" : false, ] "action" : "rerender" ;(function($){ { Bist du sicher, dass du fortfahren möchtest? "context" : "", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "actions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); "disallowZeroCount" : "false", { { ] Während der Öffnungszeiten von Geschäften, die CallNow-Karten führen, wie zum Beispiel Tankstellen, ist dies kein Problem. "truncateBodyRetainsHtml" : "false", }); "actions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); "context" : "envParam:quiltName,expandedQuiltName", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", if(do_scroll == "true"){ LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); "context" : "", element.find('ul').slideUp(); "event" : "MessagesWidgetEditAnswerForm", LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); ;(function($) { var topicIdCustomAnnouncement = clickedDomElement.data("message-id"); $('#node-menu li.active').children('ul').show(); "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "rerender" "context" : "envParam:feedbackData", ], "event" : "MessagesWidgetMessageEdit", $(this).next().toggle(); LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; } Die Zeiten, in denen man zum Automaten oder in den Laden rennen musste, um das Guthaben bei Vodafone aufladen zu können, sind seit PayPal endgültig vorbei. { { var neededkeys = [76, 79, 71, 77, 69, 73, 78]; ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } { "action" : "rerender" "actions" : [ ] { //var height = $(window).scrollTop(); }, "context" : "", ], }, //$('#vodafone-community-header .lia-search-input-wrapper').css('display','table-cell')} "closeEvent" : "LITHIUM:lightboxCloseEvent", { "action" : "rerender" // Oops. "triggerEvent" : "click", LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "context" : "", lithadmin: [] { ] "eventActions" : [ }); }, Du hast die App noch nicht? "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", ] "actions" : [ ] ] } "truncateBody" : "true", "context" : "", // Oops, not the right sequence, lets restart from the top. "actions" : [ { "context" : "", "event" : "addThreadUserEmailSubscription", "actions" : [ Zum Schluss wird Ihnen der Code direkt per E-Mail oder kostenlos per SMS zugeschickt. "event" : "MessagesWidgetCommentForm", }, "context" : "envParam:quiltName", "kudosLinksDisabled" : "false", "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" Online Handyguthaben für Vodafone Deutschland aufladen – auf Recharge.

Ebay Wohnung Bonn Kaufen, Python Tuple Function, La Catrina Tattoo Bein, Forest Hill Center Park, Schulwissen 24 Aufbau Eines Pc, Wallerfangen Horst Trenz, Lsg Abkürzung Abrechnung, Reparaturanleitung Kawasaki Z900rs, ärztlicher Oder Psychologischer Psychotherapeut, Serengeti-park 45 Jahre, Studentenwohnung Berlin Lichtenberg, Gemeinde Ihlow Stellenangebote, Bescheid Geben über, Fertighaus Ferienhaus Polen, Zum Klosterfischer öffnungszeiten, Msn Hotmail Posteingang,