vodafone login funktioniert nicht 2020

] "actions" : [ }, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "displaySubject" : "true", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", }, // enable redirect to login page when "logmein" is typed into the void =) "action" : "rerender" "revokeMode" : "true", "context" : "", }, $(this).toggleClass("view-btn-open view-btn-close"); "revokeMode" : "true", { "event" : "MessagesWidgetMessageEdit", }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", "triggerEvent" : "click", }, Arcor gibt es seit 2008 nicht mehr. } var count = 0; "useCountToKudo" : "false", }, ] "actions" : [ } ] { "actions" : [ "action" : "rerender" "componentId" : "forums.widget.message-view", "disallowZeroCount" : "false", } "context" : "", "useSubjectIcons" : "true", "context" : "", "event" : "removeMessageUserEmailSubscription", { { { ] ', 'ajax'); "actions" : [ "actions" : [ ] "event" : "MessagesWidgetEditAnswerForm", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); { "entity" : "2443863", { }, if ( key == neededkeys[0] ) { { { "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ }, "event" : "MessagesWidgetMessageEdit", count = 0; "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "", } "parameters" : { "context" : "envParam:quiltName,message", }, "actions" : [ ] ctaHTML += "Lösung noch nicht gefunden? }, "actions" : [ ] "action" : "rerender" ] "eventActions" : [ "linkDisabled" : "false" ] }, "event" : "addMessageUserEmailSubscription", { "context" : "", "event" : "ProductAnswer", { LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "MessagesWidgetEditAction", { "context" : "", "action" : "rerender" "disableLabelLinks" : "false", "actions" : [ "disableLabelLinks" : "false", "initiatorBinding" : true, "initiatorBinding" : true, "action" : "rerender" "event" : "addThreadUserEmailSubscription", "event" : "addMessageUserEmailSubscription", logmein: [76, 79, 71, 77, 69, 73, 78], "event" : "ProductAnswerComment", LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2438892,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "context" : "lia-deleted-state", "parameters" : { "event" : "kudoEntity", element.children('ul').slideDown(); "context" : "", ] } "initiatorBinding" : true, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); Login bei MeinVodafone geht nicht – so beheben Sie das Problem. "event" : "markAsSpamWithoutRedirect", }); "action" : "rerender" "action" : "rerender" "actions" : [ ] } }, { "useSimpleView" : "false", "initiatorDataMatcher" : "data-lia-kudos-id" }, }, { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_8","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_8","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/7001/thread-id/102688","ajaxErrorEventName":"LITHIUM:ajaxError","token":"rHNmMGFg-lJhNoCZDp7oG0-i_pgCphZ51gzwafeNB2Q. { "useTruncatedSubject" : "true", "initiatorBinding" : true, "componentId" : "kudos.widget.button", }, "event" : "editProductMessage", "action" : "pulsate" "action" : "rerender" "action" : "rerender" "entity" : "2443863", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"}); "}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2438892 .lia-rating-control-passive', '#form_6'); ] "action" : "addClassName" "action" : "rerender" "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ return; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_44","feedbackSelector":".InfoMessage"}); "action" : "rerender" "action" : "rerender" { "actions" : [ { "truncateBody" : "true", "context" : "", $(this).toggleClass("view-btn-open view-btn-close"); "event" : "approveMessage", "displaySubject" : "true", "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, } } { } "kudosLinksDisabled" : "false", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_4","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/7001/thread-id/102688","ajaxErrorEventName":"LITHIUM:ajaxError","token":"PjHRimDGNeSuZhuKaF2qSAuyiTQwnpAaXaSgkyYVYZg. "initiatorBinding" : true, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/7001/thread-id/102688","ajaxErrorEventName":"LITHIUM:ajaxError","token":"OvZ14X4cP93tatmM0vNYSb1BYiTHu0FqlPieaAkgdf8. ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } $(document).keydown(function(e) { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "deleteMessage", if ( !watching ) { "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName", "event" : "MessagesWidgetEditCommentForm", if ( !watching ) { ], "action" : "rerender" } "event" : "approveMessage", "context" : "envParam:quiltName,message", ] "action" : "rerender" "context" : "", } ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:refresh_attachment_statuses","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#attachments_0_77ac6ea38f9093","action":"refresh_attachment_statuses","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.attachments_0:refresh_attachment_statuses?t:ac=board-id/7001/thread-id/102688&t:cp=messages/contributions/messageviewparameterscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"TY7qtSFaOy_WrDcrRra6A8ociogzhxcyDw5eg76Ozrk. "actions" : [ "event" : "QuickReply", { "context" : "", "action" : "pulsate" "action" : "pulsate" "quiltName" : "ForumMessage", $(this).toggleClass("view-btn-open view-btn-close"); } { "action" : "pulsate" { LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "rerender" "action" : "rerender" ', 'ajax'); "actions" : [ "context" : "", }, ] ], { "actions" : [ "event" : "markAsSpamWithoutRedirect", } var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "action" : "rerender" "displayStyle" : "horizontal", LITHIUM.Auth.CHECK_SESSION_TOKEN = 'bNyeyNUYhd-5lgDoUJxzO8Lx31rNRFwaF8WABjagjp4. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.Dialog.options['-1040003818'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "disableLinks" : "false", { { "action" : "rerender" { ], "truncateBodyRetainsHtml" : "false", "event" : "MessagesWidgetEditAnswerForm", "action" : "rerender" "context" : "", "actions" : [ "context" : "", "useSimpleView" : "false", { "action" : "rerender" "entity" : "2437568", ] ] "event" : "QuickReply", $('#node-menu li.active').children('ul').show(); "context" : "envParam:entity", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] }); }, "actions" : [ }, "context" : "", "event" : "QuickReply", { ] "context" : "envParam:quiltName,expandedQuiltName", { }, "initiatorBinding" : true, "includeRepliesModerationState" : "false", "closeEvent" : "LITHIUM:lightboxCloseEvent", { "actions" : [ ] /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_38","feedbackSelector":".InfoMessage"}); "componentId" : "forums.widget.message-view", "useSimpleView" : "false", "messageViewOptions" : "1111110111111111111110111110100101001101" "actions" : [ "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, 'NCByBzjOBWFGpRcWn-j9hcyLfrhN2JmAV67109s0Nk8. return; } } }, }, LITHIUM.AjaxSupport.ComponentEvents.set({ ] }, "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); "action" : "rerender" LITHIUM.Dialog.options['62748831'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; watching = true; "actions" : [ } } "context" : "envParam:selectedMessage", ] { "action" : "rerender" "triggerSelector" : ".lia-panel-dialog-trigger-event-click", } LITHIUM.Dialog.options['1684624583'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, }); }, { "action" : "rerender" // Oops. ], "event" : "RevokeSolutionAction", "actions" : [ "actions" : [ "actions" : [ "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, 'CXolZYF8m673A3Q4M1pO3lIhBIbBGPFkr9ISkWRT-MQ. { "event" : "unapproveMessage", }); "event" : "MessagesWidgetEditAction", { "context" : "envParam:quiltName,message", { count = 0; }, }, "action" : "rerender" }); ] { { "revokeMode" : "true", "showCountOnly" : "false", "context" : "envParam:selectedMessage", } // Set start to true only if the first key in the sequence is pressed "action" : "rerender" "actions" : [ { var count = 0; "eventActions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "action" : "pulsate" "message" : "2562122", "actions" : [ { } } "action" : "rerender" }); } LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_8","componentSelector":"#lineardisplaymessageviewwrapper_8","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2562122,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. // We made it! ', 'ajax'); { "action" : "pulsate" "actions" : [ "actions" : [ { "useSimpleView" : "false", { "context" : "envParam:quiltName,product,contextId,contextUrl",

Festool Ts 55 Ebq Plus Sägeblatt, Tu Bs Qis System, Sporteignungstest Vorbereitungskurse Berlin, Wohnmobilstellplatz Den Helder, Ohne Krankenversicherung Zum Arzt österreich, Ural Oil Price, Der Mann, Der Nie Zu Spät Kam Kurzgeschichte Analyse, Threema Kostenlos Herunterladen,